Monoclonal Anti-CD1B antibody produced in mouse

NA.41

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. (provided by RefSeq)

CD1B (NP_001755.1, 19 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY

Monoclonal Anti-CD1B antibody produced in mouse is suitable for capture ELISA and indirect ELISA.

CD1B (CD1b molecule) is majorly involved in the glycolipid antigen recognition and presentation on the CD1b-restricted T Cells during the T cell-mediated immune responses. The antigen-binding groove directly links to the acyl chains of lipid antigens, which allows the hydrophilic components to interact with T cell antigen receptors.

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2E4, monoclonal

buffered aqueous solution

antigen ~36.23 kDa

human

capture ELISA: suitable
indirect ELISA: suitable

IgG2aκ

NM_001764

P29016

dry ice

−20℃

human ... CD1B(910)

13 - Non Combustible Solids

WGK 1