Monoclonal Anti-DOT1L antibody produced in mouse

NA.41

Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L) is encoded by the gene mapped to human chromosome 19p13.3.

DOT1L (NP_115871, 3 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR

Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L), is a nucleosomal enzyme that catalyzes the intra-nucleosomal methylation of H3 at lysine-79, a crucial step involved in the regulation of cell cycle, transcriptional regulation, and DNA damage response. Mammalian DOT1 gene plays an essential role in embryogenesis, hematopoiesis, cardiac function, and development of leukemia. Thus, DOT1L can act as a potential target for therapeutic treatment of the same. Elevated DOT1L enzymatic activity leads to MLL (mixed-lineage leukemia). Therefore, inhibition of DOT1L by SYC-522 in combination with DNA-damaging chemotherapy is considered as a potential treatment for MLL.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

6A6, monoclonal

buffered aqueous solution

human

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

NM_032482

Q8TEK3

dry ice

−20℃

human ... DOT1L(84444)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)