Monoclonal Anti-GFRA1 antibody produced in mouse

MFCD01865527

NA.41

Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. (provided by RefSeq).
Glial cell derived neurotrophic factor (GDNF) family receptor alpha 1 (GFRA1) gene is located on human chromosome 10q25.3. GFRA1 is the co-receptor for GDNF. GFRA1 is expressed in spermatogonia.

GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS

Glial cell derived neurotrophic factor (GDNF) family receptor alpha 1 (GFRA1) regulates progression and metastasis of breast and pancreatic cancer and thereby, promotes migration and invasion. Deficiency of GFRA1 in Alzheimer′s neurons is linked to neuronal death. GFRA1 helps in the GDNF-induced replication of spermatogonial stem cells (SSCs). It is important for spermatogonial development.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1G4, monoclonal

buffered aqueous solution

human

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_005264

P56159

dry ice

−20℃

human ... GFRA1(2674)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)