Monoclonal Anti-GRHL3 antibody produced in mouse

NA.41

Grainyhead-like 3 (GRHL3), also known as GET1, is encoded by the gene mapped to human chromosome 1p36.11. GRHL3 is one of the mammalian homologues of Grh gene.

GRHL3 (NP_067003, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPD

Grainyhead-like 3 (GRHL3) stimulates gene expression programs involved in various cellular processes, such as cell adhesion, lipid production, cornified envelope formation and protein crosslinking. In addition, it also facilitates keratinocyte migration during eyelid closure and wound healing. Missense mutation in the gene is associated with the development of nonsyndromic cleft palate. In addition, variation in the gene also leads to Van der Woude syndrome (VWS). The protein expression can be used as a diagnostic factor for germinal center B cell (GCB) /non-GCB of diffuse large B cell lymphoma.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

3C5, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_021180

Q8TE85

dry ice

−20℃

human ... GRHL3(57822)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)