Monoclonal Anti-IL8 antibody produced in mouse

NA.41

Interleukin 8 (IL-8) is an 8& kDa, 72 amino acid residue containing cytokine that belongs to C-X-C chemokine family. The IL-8 gene is mapped to human chromosomes 4q13.3. IL-8 chemokine is secreted by several cell types. The IL-8 gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.

IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.

Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Elevated expression of IL-8 gene is observed in a number of cancers including chronic spontaneous urticaria and breast cancer, thus serves as a prognostic marker for the same. IL-8 regulates the metastasis and angiogenesis processes during cancer development. IL-8 is responsible for epithelial–mesenchymal transition which plays an important role in providing cancer cells the mobility to invade other neighbouring cells, thereby contributing to metastasis.
Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.

Solution in phosphate buffered saline, pH 7.4

mouse

unconjugated

purified immunoglobulin

primary antibodies

4E3, monoclonal

buffered aqueous solution

antigen 8.69 kDa

human

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2bκ

BC013615

dry ice

−20℃

human ... IL8(3576)

12 - Non Combustible Liquids

WGK 3