Monoclonal Anti-RARB antibody produced in mouse

MFCD00802879

NA.41

This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined. (provided by RefSeq)

RARB (AAH60794, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEG

RARB (Retinoic acid receptor, β) is a tumor suppressor gene. It interacts weakly with silencing mediator of retinoic acid and thyroid hormone receptor (SMRT) corepressor protein. It plays a pivotal role in mediating the retinoid signaling during morphogenesis, development, and cell differentiation. RARB plays an important role in retinoic acid pathway during eye development and organogenesis. Any recessive and dominant mutation in RARB causes anophthalmia and/or microphthalmia and diaphragmatic hernia. The suppression of RARB by DNA methylation and EZH2 leads to the gene silencing during prostate tumorigenesis.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1F7, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

BC060794

P10826

dry ice

−20℃

human ... RARB(5915)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)