Monoclonal Anti-RUNX2 antibody produced in mouse

NA.41

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. (provided by RefSeq)

RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA

Solution in phosphate buffered saline, pH 7.4

mouse

unconjugated

purified immunoglobulin

primary antibodies

4D5, monoclonal

buffered aqueous solution

antigen ~37.11 kDa

rat, human

capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_004348

Q13950

dry ice

−20℃

human ... RUNX2(860)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1