Monoclonal Anti-SOD3 antibody produced in mouse

MFCD08705522

NA.41

This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM. (provided by RefSeq)

SOD3 (AAH14418, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

5C3, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgGκ

BC014418

P08294

dry ice

−20℃

human ... SOD3(6649)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)