Monoclonal Anti-ST3GAL5 antibody produced in mouse

NA.41

Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

ST3GAL5 (NP_003887, 31 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQT

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

mouse

unconjugated

purified immunoglobulin

primary antibodies

8B4, monoclonal

buffered aqueous solution

antigen 35.31 kDa

human

ELISA: suitable
western blot: 1-5 μg/mL

IgG2a

NM_003896

Q9UNP4

dry ice

−20℃

human ... ST3GAL5(8869)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1