Monoclonal Anti-USP48 antibody produced in mouse

NA.41

This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

USP48 (NP_115612, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAY

Ubiquitin specific peptidase 48 (USP48) is a deubiquitinylating enzyme, that catalyzes the removal of ubiquitin (Ub) moieties from proteins. Inhibition of USP48 by dopamine D3 receptor (D3R) enhances Na⁺-H⁺ exchanger (NHE)-3 degradation, which is essential for regulation of blood pressure and sodium balance.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

3G4, monoclonal

buffered aqueous solution

human

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

NM_032236

Q86UV5

dry ice

−20℃

human ... USP48(84196)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)