Anti-ACCN2 antibody produced in rabbit

NA.41

The immunogen for anti-ACCN2 antibody: synthetic peptide derected towards the N terminal of human ACCN2

Accn2 is a cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. It also permeable for Ca2+, Li+ and K+. It generates a biphasic current with a fast inactivating and a slow sustained phase and mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Accn2 functions as a postsynaptic proton receptor that influences intracellular Ca2+ concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. It modulates activity in the circuits underlying innate fear.

Synthetic peptide located within the following region: MELKTEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

60 kDa

mouse, human, rat, guinea pig, rabbit, dog, horse

0.5 mg - 1 mg/mL

western blot: suitable

NM_009597

Q6NXK8

wet ice

−20℃

human ... ASIC1(41)
mouse ... Accn2(11419)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3