Anti-ACE2 antibody produced in rabbit

HPA000288    Human Protein Atlas characterization data

Angiotensin-converting enzyme-2 (ACE2) is a homolog of angiotensin-I converting enzyme (ACE). ACE2 is a member of the renin-angiotensin system (RAS) which performs functions similar to carboxypeptidase. This 805 amino acid protein is localized in human kidney. The ACE2 gene is located at human chromosome Xp22.2. It contains a N-terminal peptidase domain (PD) and the C-terminal collectrin-like domain (CLD).
Angiotensin-converting enzyme 2 (ACE2) is mapped to human chromosome Xp22.2. It is a homolog of ACE and shares 42% sequence identity. ACE2 is expressed in kidney, gastrointestinal and cardiovascular tissues.

Angiotensin-converting enzyme 2 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-ACE2 antibody produced in rabbit has been used for immunohistochemistry at a dilution of 1:500-1:1000. It has also been used in western blotting at a working concentration of 0.04-0.4 μg/ml.

Angiotensin-converting enzyme (ACE2) catalyzes the degradation of angiotensin (Ang) II to Ang (1-7). The deficiency ACE2 or its inhibition by ang II is implicated in the pathogenesis of cardiac hypertrophy and myocardial dysfunction. ACE2 is multifunctional and is incapable of hydrolyzing bradykinin. In patients with CTD (connective tissue disease), serum autoantibodies suppress ACE2, which leads to a decrease in the physiological levels of vasoprotective agent Ang (1-7) in the vascular milieu. Activation or administration of ACE2 in patients with CTD may serve as a therapeutic method for treating pulmonary arterial hypertension (PAH), or persistent digital ischemia. It also plays a regulatory role in lung diseases and pulmonary fibrosis. The human ACE2 receptor is recognized by severe acute respiratory syndrome (SARS-CoV) coronaviruses (CoVs) 2. This interaction paves a way for the transmission of infection.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74018.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED

Q9BYF1

wet ice

−20℃

human ... ACE2(59272)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)