Anti-ADRB1 antibody produced in rabbit

MFCD01321640

NA.41

Synthetic peptide directed towards the middle region of human ADRB1

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

51 kDa

mouse, pig, human, rat

pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder

0.5 mg - 1 mg/mL

western blot: suitable

P08588

−20℃

human ... ADRB1(153)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3