Anti-AGAP2 antibody produced in rabbit

HPA023474    Human Protein Atlas characterization data

The gene AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2) belongs to the group of proteins called AZAPs that contain a catalytic core of PH (pleckstrin homology), Arf GAP and two or more ankyrin repeat domains. The AZAP family is further divided into four subfamilies, of which AGAPs contain an NH₂-terminal GTPase-like domain (GLD), a split PH domain, and the GAP domain followed by four ankyrin repeats. Agap2 is found to be overexpressed in various human cancers.

Arf-GAP, GTPase, ANK repeat and PH domain-containing protein 2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

The gene AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2) encodes an Arf GAP (GTPase activating protein) that catalyzes the hydrolysis of GTP bound to Arf (ADP-ribosylation factors). The AGAPs are involved in the regulation of membrane trafficking and remodeling of the actin cytoskeleton. AGAP2 is found to associate with the clathrin adaptor protein AP-1 (activator protein 1) and participate in endosomal trafficking that is dependent on AP-1/Rab4 (RAS-related GTP-binding protein). It is also involved in facilitating the invasion of glioblastoma cells. Agap2 interacts with FAK (focal adhesion kinase) to form a complex and increase its activity, thereby promoting focal adhesion disassembly, resulting in increased cell migration.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73835.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE

Q99490

wet ice

−20℃

human ... AGAP2(116986)

12 - Non Combustible Liquids

WGK 1