Anti-APCS antibody produced in rabbit

NA.41

Amyloid P component (AP) is a constituent of in vivo amyloid deposits found in diseases called amyloidoses. AP is believed to stabilize the ordered aggregation of normal and globular proteins and peptides in amyloid deposits and to prevent their removal by protein scavenging processes.

Anti-Amyloid P component, serum reacts with human, mouse, pig amyloid P component proteins.

Synthetic peptide directed towards the N terminal region of human APCS

Anti-APCS antibody is used to tag amyloid P component, serum (APS) proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role or amyloid P component in amyloid development, stabilization, and localization.

APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites.

Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

25 kDa

human

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001630

P02743

wet ice

−20℃

human ... APCS(325)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3