Anti-ARMCX6 antibody produced in rabbit

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

33 kDa

human, mouse

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_061880

Q7L4S7

wet ice

−20℃

human ... ARMCX6(54470)

Synthetic peptide directed towards the N terminal region of human ARMCX6

Anti-ARMCX6 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

ARMCX6 is a member of the armadillo family of proteins that are involved in embryogenesis and tumorigenesis. The expression of ARMCX6 is high in pancreas and spleen. The mRNA of ARMCX6 is almost two-fold in peripheral blood mononuclear cells of rheumatoid arthritis patients. It may be a useful marker for carcinogenesis.

Synthetic peptide located within the following region: TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3