Anti-ATP8B1 antibody produced in rabbit

HPA018674    Human Protein Atlas characterization data

The gene ATPase class I type 8B member-1 (ATP8B1) is mapped to human chromosome 18q21.31. It belongs to family of P4-ATPases. ATP8B1 is present in many epithelial tissues with strong expression in small intestine. In Chinese hamster ovary cells, the protein localizes to the endoplasmic reticulum when expressed alone. However, co-expression of CDC50A (Cell cycle control protein 50A) moves ATP8B1 to the plasma membrane.

Probable phospholipid-transporting ATPase IC recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

ATPase class I type 8B member-1 (ATP8B1) is a flippase which facilitates transport of aminophospholipids from the outer to inner hemi-leaflet of the lipid bilayer. Co-expression of CDC50A (Cell cycle control protein 50A) along with ATP8B1 is crucial for ATP8B1 functioning. They together have been shown to internalize phosphatidylserine and anticancer drug perifosine. Mutations in ATP8B1 cause progressive familial intrahepatic cholestasis type 1 and benign recurrent intrahepatic cholestasis type 1.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74621.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

independent
Learn more about Antibody Enhanced Validation

immunohistochemistry: 1:20- 1:50

KIWVLTGDKKETAENIGFACELLTEDTTICYGEDINSLLHARMENQRNRGGVYAKFAPPVQESFFPPGGNRALII

O43520

wet ice

−20℃

human ... ATP8B1(5205)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1