Anti-ATXN2 antibody produced in rabbit

HPA021146    Human Protein Atlas characterization data

The gene ataxin-2 (ATXN2) is mapped to human chromosome 12q24.1. The protein belongs to ataxin-2 family. ATXN2 is present at the endoplasmic reticulum, plasma membrane and trans-Golgi network depending on the interacting partner.

Ataxin-2 recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Unstable expansion of ataxin-2 (ATXN2) polyglutamine domain causes neurodegenerative diseases including spinocerebellar ataxia type-2, frontotemporal dementia and amyotrophic lateral sclerosis. Mode of action involves ATXN2 association with polyribosomes and poly(A) binding protein, thereby interfering with the translational regulation of particular mRNAs. Single nucleotide polymorphism in ATXN2 is associated with schizophrenia. ATXN2 is associated with the endocytosis complex and plays a role in endocytic receptor cycling.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73803.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

RHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNET

Q99700

wet ice

−20℃

human ... ATXN2(6311)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1