Anti-AVIL antibody produced in rabbit

NA.41

The immunogen for anti-AVIL antibody: synthetic peptide derected towards the N terminal of human AVIL

Avil is a Ca2+-regulated actin-binding protein. It may have a unique function in the morphogenesis of neuronal cells which form ganglia. It is required for SREC1-mediated regulation of neurite-like outgrowth. It plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. It is involved in the formation of long fine actin-containing filopodia-like structures in fibroblast and is required for SREC1-mediated regulation of neurite-like outgrowth. Avil plays a role in ciliogenesis.

Synthetic peptide located within the following region: SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

91 kDa

guinea pig, bovine, horse, mouse, human, rat, rabbit, dog

0.5 mg - 1 mg/mL

western blot: suitable

NM_024401

Q9WU06

wet ice

−20℃

human ... AVIL(10677)
rat ... Avil(79253)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3