Anti-BAT5 (ab2) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human BAT5

A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity.

Synthetic peptide located within the following region: VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

63 kDa

human, rat, mouse, dog, horse, bovine, guinea pig

0.5 mg - 1 mg/mL

western blot: suitable

O95870

wet ice

−20℃

human ... BAT5(7920)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3