Anti-C12orf42 antibody produced in rabbit

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

40 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_001092806

Q96LP6

wet ice

−20℃

human ... C12orf42(374470)

The open reading frame C12orf42 is a hypotheical protein of unknown function and is located 22.7kb upstream of 2 SNPs (single nucleotide polymorphisms) associated with restenosis. This gene was seen to be upregulated upon treatment with TGF-β superfamily of growth factors called bone morphogenetic proteins (BMPs) on global gene transcription in breast cancer cell lines. Chromosome 12 makes up about 4.5% of the human genome. It encodes over 1,100 genes within 132 million bases. A number of deformities such as osteoarthritis, kniest dysplasia, hypochondrogenesis and achondrogenesis are linked to chromosome 12. A gene for Noonan syndrome, which includes heart and facial developmental defects is located on chromosome 12.

Synthetic peptide directed towards the N terminal region of human C12orf42

Anti-C12ORF42 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

The exact function of C12orf42 remains unknown.

Synthetic peptide located within the following region: PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3