Anti-C16ORF44 antibody produced in rabbit

NA.41

C16ORF44 (KLHL36) is a protein member of the kelch-like family.
Rabbit Anti-C16ORF44 antibody recognizes zebrafish, human, mouse, rat, bovine, and canine C16ORF44.
The gene KLHL36 (kelch like family member 36) encodes a member of the Kelch-like (KLHL) protein family, the members of which contain a BTB/POZ (Broad-Complex, Tramtrack and Bric a brac/ POxvirus and Zinc finger) domain, a BACK (BTB and C-terminal Kelch) domain, and five to six Kelch motifs. The BTB domain participates in protein association and dimerization. The kelch domains form a tertiary structure of β-propellers that function in several extracellular processes, such as morphology and protein association. The function of the BACK domain is yet to be characterized. However, mutations in this domain are associated with disease. Around 42 KLHL genes have been identified across multiple human chromosomes. The encoded protein is 616 amino acids long.

Synthetic peptide directed towards the N terminal region of human C16ORF44

Rabbit Anti-C16ORF44 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

C16orf44 is an open reading frame 44, found in chromosome 16

Synthetic peptide located within the following region: FCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPD

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

70 kDa

guinea pig, mouse, rabbit, rat, human, bovine, dog

0.5 mg - 1 mg/mL

western blot: suitable

NP_079007

Q8N4N3

wet ice

−20℃

human ... C16ORF44(79786)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3