Anti-CLIC1 (AB2) antibody produced in rabbit

NA.41

CLIC1 codes for an intracellular chloride ion channel protein. Studies have reported that oxidized CLIC1 dimers can form chloride ion channels in synthetic vesicles and bilayers. In the absence of detergents, CLIC1 can spontaneously insert into preformed membranes.
Rabbit Anti-CLIC1 antibody recognizes rabbit, canine, zebrafish, bovine, human, mouse, rat, and pig CLIC1.

Synthetic peptide directed towards the N terminal region of human CLIC1

Rabbit Anti-CLIC1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml and for IHC at 4-8 μg/ml.

Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

27 kDa

bovine, goat, horse, dog, rat, rabbit, guinea pig, human, mouse

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001279

Q502X1

wet ice

−20℃

human ... CLIC1(1192)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 3