Anti-CNNM4 antibody produced in rabbit

HPA017732    Human Protein Atlas characterization data

Ancient conserved domain-containing protein 4 (CNNM4) contains a highly conserved domain which is evolutionarily conserved from bacteria to mammals. In total, it has four transmembrane domains. CNNM4 is expressed in the gastrointestinal tract, neural retina and ameloblasts of the developing tooth. The gene encoding it is present on chromosome 2q11.

cyclin and CBS domain divalent metal cation transport mediator 4

Anti-CNNM4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ancient conserved domain-containing protein 4 (CNNM4) is involved in metal ion transport. It may remove unwanted Mg²⁺ ions which interfere with crystal formation in enamel and thus maintain the serum Mg²⁺ levels. In the epithelium, CNNM4 expels intracellular Mg²⁺ outside the cells in exchange for Na⁺. It binds to the enzyme phosphatase of regenerating liver (PRL) which is up-regulated in malignant human cancers. Along with PRL, CNNM4 is involved in energy metabolism and 5′ AMP-activated protein kinase (AMPK)/ mechanistic target of rapamycin (mTOR) signaling. Mutations in CNNM4 have been shown to be associated with recessive cone-rod dystrophy and amelogenesis imperfecta (Jalili syndrome).

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73140.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunohistochemistry: 1:200- 1:500

FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL

Q6P4Q7

wet ice

−20℃

human ... CNNM4(26504)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)