Anti-CSNK1E, (N-terminal) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human CSNK1E

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene.

Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

47 kDa

sheep, mouse, rat, dog, rabbit, human, horse, guinea pig, bovine

0.5 mg - 1 mg/mL

western blot: suitable

NM_001894

P49674

wet ice

−20℃

human ... CSNK1E(1454)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3