Anti-DDX20 antibody produced in rabbit

HPA005516    Human Protein Atlas characterization data

DDX20 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 20) belongs to DExD/H-box family of proteins. This family is characterized by Asp-Glu-Ala-Asp/His motif present in their helicase domain. DDX20 is made of 824 amino acids. It is an RNA helicase and forms a part of the SMN (survival-of-motor-neurons) complex. The molecular weight of this protein is 103kDa. DDX20 has a hydrophobic N-terminal, and two hydrophilic regions in its C-terminal. In humans, its expression varies in accordance with the type of tissue, and shows a high level of expression in testis. During spermatogenesis in humans, DDX20 is localized to the chromtoid body structure in germ cells. This gene is located at human chromosome 1p21.1-p13.2.

Probable ATP-dependent RNA helicase DDX20 recombinant protein epitope signature tag (PrEST)

Anti-DDX20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

DDX20 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 20) plays an essential role in early embryonic development, where it is involved in silencing of maternal transcripts and processing of RNA. It forms a core part of SMN (survival of motor neurons) complex, which is involved in the processing and assembly of RNPs (ribonucleoproteins), such as, snRNPs (spliceosomes), snoRNPs, miRNPs, hnRNPs and transcriptosomes. DDX20 plays a part in hind brain development where it suppresses the transcription of Egr2 (early growth response 2) gene. It regulates macrophage differentiation and proliferation, by silencing the expression of Ets target genes, involved in Ras pathway. It also acts as a cofactor in the SUMOylation of SF-1 (Steroidogenic factor 1) by PIASy (Protein inhibitor of activated STAT Y). This protein facilitates the assembly of the core of SMN complex, and this activity of DDX20 is associated with Spinal muscular atrophy (SMA). DDX20 acts as an oncogene that facilitates metastasis, in human breast cancer, and has potential as a therapeutic target for the same.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86419.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDH

Q9UHI6

wet ice

−20℃

human ... DDX20(11218)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)