Anti-FLJ22167 antibody produced in rabbit

NA.41

Transmembrane protein 231 (FLJ22167, TMEM231) is a component of a nine protein complex that is essential for normal cilia structure and signaling function.

Anti-FLJ22167 polyclonal antibody reacts with rat, human, bovine, mouse, zebrafish, and canine transmembrane protein 231 (TMEM231) proteins.

Synthetic peptide directed towards the N terminal region of human FLJ22167

Anti-FLJ22167 polyclonal antibody is used to tag transmembrane protein 231 (TMEM231) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of transmembrane protein 231 in cilia function and ciliopathies

Synthetic peptide located within the following region: CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

36 kDa

human, dog, rat, guinea pig, rabbit, bovine

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001070884

Q9H6L2

wet ice

−20℃

human ... FLJ22167(79583)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3