抗-GLI3 兔抗

HPA005534    Human Protein Atlas characterization data

GLI family zinc finger 3 (GLI3) belongs to Gli family of DNA binding proteins. There are three Gli proteins (GLI1, GLI2 and GLI3), which contain a DNA-binding domain made up of five zinc fingers. Fingers 4 and 5 recognize the Gli-binding DNA sequence, and fingers 3, 4 and 5 interact closely with DNA. Their C-terminus consists of transcriptional activator domain (TAD), and in GLI3, the repressor domain (RD) is present at the N-terminus. In humans, GLI3 gene is present on chromosome 7p13, and spans 240kb. The encoded protein consists of 1596 amino acids. This protein is expressed during early stages of development.

Zinc finger protein GLI3 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

GLI family zinc finger 3 (GLI3) is involved in the sonic hedgehog (SHH) signaling in a downstream manner. It binds to the promoter region of genes downstream to it, and regulates their expression. In forebrain, this protein suppresses ventral cell types and regulates the specification of dorsal cell types. It suppresses digit formation when expressed in the anterior portion of the limb buds. Mutations in GLI3 gene usually lead to loss of function, and are a cause of multiple disorders, such as Greig Cephalopolysyndactyly Syndrome (GCPS), Acrocallosal Syndrome, Pallister-Hall Syndrome, Pre-axial Polydactyly type IV and Post-axial Polydactyly type A. Mutation in the N-terminal of GLI3 gene is linked to esophageal atresia. GLI3 is expressed in mesenchymal and epithelial layers during tooth development. SNP rs929387 of GLI3 is associated with tooth agenesis in Chinese Han population.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77454.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:50- 1:200

GQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGA

P10071

wet ice

−20℃

human ... GLI3(2737)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)