Anti-HBZ antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human HBZ

Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5′ - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3′.Zeta-globin (HBZ ) is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that involves 4 functional genes and 3 nonfunctional pseudogenes. The order of genes is: 5′-zeta -- pseudozeta -- pseudoalpha2 -- pseudoalpha1 -- alpha2 -- alph1 -- theta1-3′.

Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

16 kDa

human

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_005323

P02008

wet ice

−20℃

human ... HBZ(3050)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3