Anti-HLTF antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human HLTF

SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.

Synthetic peptide located within the following region: SWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

114 kDa

horse, dog, human, pig, bovine, rabbit

0.5 mg - 1 mg/mL

western blot: suitable

Q14527

wet ice

−20℃

human ... HLTF(6596)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3