Anti-HMBOX1 antibody produced in rabbit

NA.41

HMBOX1 is a homeobox transcription factor that may be involved in tumorigenesis. Studies have reported that this protein associates with telomeric double-stranded DNA and binds to nuclear bodies of promyelocytic leukemia.
Rabbit Anti-HMBOX1 antibody recognizes chicken, canine, zebrafish, human, mouse, and rat HMBOX1.

Synthetic peptide directed towards the N terminal region of human HMBOX1

Rabbit Anti-HMBOX1 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

HMBOX1 is located at the boundary of 8p12.3 and 8p21.1. HMBOX1 proteins are highly conserved in human, mouse, rat, chicken and Xenopus laevis. Functional HMBOX1::EGFP (enhanced green fluorescent protein) fusion protein revealed that HMBOX1 accumulated more in cytoplasm than in nucleus. HMBOX1 is a transcription repressor. Human HMBOX1 is widely expressed in 18 tissues, and it is highly expressed in pancreas. Hmbox1 is widely expressed in mouse pancreas and the expression of this gene can also be detected in pallium, hippocampus and hypothalamus.

Synthetic peptide located within the following region: ETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

47 kDa

rat, horse, guinea pig, dog, mouse, rabbit, human, bovine

0.5 mg - 1 mg/mL

western blot: suitable

NP_001129198

Q6NT76

wet ice

−20℃

human ... HMBOX1(79618)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1