Anti-IL1R2 antibody produced in rabbit

HPA027598    Human Protein Atlas characterization data

Interleukin 1 receptor type 2 (IL1R2) comprises three immunoglobulin-like extracellular domains and a single helical transmembrane domain but lacks an intracellular Toll/interleukin-1 receptor (TIR) domain. It is a glycoprotein that exists in membrane-bound and soluble forms. IL1R2 is associated with macrophages, B-cells, and neutrophils. The IL1R2 gene is mapped to human chromosome 2q11.2.

interleukin 1 receptor, type II recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-IL1R2 antibody produced in rabbit has been used in immunohistochemistry.

Interleukin 1 receptor type 2 (IL1R2) is a decoy receptor that lacks signaling functionality. IL1R2 may serve as a target to treat IL-1-mediated inflammatory diseases. It is implicated in the pathophysiology of various disease states including autoimmune inner ear disease (AIED), Alzheime′s disease, and ulcerative colitis. Polymorphisms in IL1R2, as well as IL1R1, are implicated in high?altitude pulmonary edema (HAPE). Elevated levels of the soluble isoform of IL1R2 are reported in sepsis and rheumatoid arthritis disease states. It acts as a negative regulator of collagen-induced arthritis (CIA). Oxygen radicals exposure effectively triggers IL1R2 expression levels.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78072.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

recombinant expression
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

GALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDK

P27930

wet ice

−20℃

human ... IL1R2(7850)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10;12 - Combustible liquids;Non Combustible Liquids

WGK 1