Anti-KLHL7 antibody produced in rabbit

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

62 kDa

rat, rabbit, horse, human, guinea pig, mouse, dog

0.5 mg - 1 mg/mL

western blot: suitable

NM_018846

Q8IXQ5

wet ice

−20℃

human ... KLHL7(55975)

Kelch like family member 7 (KLHL7) has BTB (bric-a-brac, tram track, and broad complex) domain in its N-terminal, BACK (BTB and C-terminal Kelch) domain and kelch domain. In human chromosome, the gene KLHL7 is localized on 7p15.3.

Synthetic peptide directed towards the middle region of human KLHL7

KLHL7 mediates ubiquitin-proteasome protein-degradation pathway by ubiquitinating cullin (E3) ligase complexes. Mutations in KLHL7 leads to autosomal dominant retinitis pigmentosa, leading to loss of rods and cones photoreceptors. Mutations in KLHL7 also leads to autosomal recessive crisponi syndrome (CS)/cold-induced sweating syndrome type 1 (CISS1), with high lethality in neonates. KLHL7 is associated with various cancers and Sjogren′s syndrome, an autoimmune disorder.

Synthetic peptide located within the following region: AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3