Anti-LASS2 antibody produced in rabbit

NA.41

LASS2 or CERS2 may regulate cell growth in humans. Furthermore, LASS2 is known to function as a target of miR-221- and miR222-mediated Schwann cell proliferation, post sciatic nerve injury.
Rabbit Anti-LASS2 antibody recognizes bovine, canine, human, mouse, and rat LASS2.

Synthetic peptide directed towards the N terminal region of human LASS2

Rabbit Anti-LASS2 antibody can be used for western blot assays at a concentration of 0.25μg/ml.

LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth.This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.

Synthetic peptide located within the following region: IVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

45 kDa

mouse, rat, guinea pig, human

0.5 mg - 1 mg/mL

western blot: suitable

NP_071358

Q96G23

wet ice

−20℃

human ... LASS2(29956)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3