抗-NEK7 兔抗

HPA018193    Human Protein Atlas characterization data

The gene never in mitosis A-related kinase-7 (NEK7) is mapped to human chromosome 1q31.3. This protein belongs to the NIMA-related family of serine/threonine kinases which are conserved and crucial regulators of mitosis and cilia formation. RT-PCR analysis showed NEK7 expression in tissues of lungs, muscle, testis, brain, heart, liver, leukocyte and spleen. NEK7 is located at the centrosome, as well as in the cytoplasm. The kinase activity of NEK7 oscillates during the cell cycle, reaching highest at M phase.

Serine/threonine-protein kinase Nek7 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Never in mitosis A-related kinase-7 (NEK7) is up-regulated in gallbladder carcinoma and is associated with shorter overall survival time. Absence of NEK7 results in microtubule dynamic instability inversed by NEK7 overexpression. NEK7 is important for proper spindle formation during mitosis. NEK7 is also involved in recruitment of centrosomal pericentriolar material proteins, which are essential for centriole duplication and spindle pole formation. NEK9, another NIMA family kinase activates NEK7 via phosphorylation.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73508.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

VCLLPVWERRVCALNACYFLEIIKGSESLQYMATLTNLFENLPVSHHGSFA

Q8TDX7

wet ice

−20℃

human ... NEK7(140609)

10 - Combustible liquids

WGK 1