Anti-NRARP antibody produced in rabbit

NA.41

NRARP (NOTCH-regulated ankyrin repeat protein) works as a negative feedback regulator in Notch (neurogenic locus notch homolog protein) signaling. On the other hand, expression of NRARP is controlled by Notch protein. The protein has two ankyrin repeats.

Synthetic peptide directed towards the middle region of human NRARP

During development, NRARP (NOTCH-regulated ankyrin repeat protein) is involved in crosstalk between NOTCH (neurogenic locus notch homolog protein) and WNT (wingless-type mouse mammary tumor virus integration site) signaling. Presence of NRARP allows proper vessel density in angiogenesis. In breast cancer, NRARP might enhances the cell proliferation. It is upregulated in thyroid cancer tissues and is associated with cell growth and invasion. It is also overexpressed in hepatocellular carcinoma tumor tissues.

Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

12 kDa

mouse, rat, human, bovine, dog, pig

0.5 mg - 1 mg/mL

western blot: suitable

NM_001004354

Q7Z6K4

wet ice

−20℃

human ... NRARP(441478)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3