Anti-NT5C3 antibody produced in rabbit

NA.41

5′-Nucleotidase, cytosolic III/uridine 5′- monophosphate hydrolase (NT5C3, UMPH) is an enzyme that catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. NT5C3 also metabolizes nucleoside analogs such as gemcitabine and cytosine arabinoside (AraC) leading to possible cytotoxicity.
Rabbit polyclonal anti-NT5C3 antibody reacts with bovine, human, mouse, rat, chicken, zebrafish, rabbit, and canine 5′-Nucleotidase, cytosolic III/uridine 5-prime monophosphate hydrolases.

Synthetic peptide directed towards the middle region of human NT5C3

Rabbit Anti-NT5C3 antibody can be used for western blot applications at a concentration of 0.5-5.0μg/ml.
Rabbit polyclonal anti-NT5C3 antibody is used to tag 5′-nucleotidase, cytosolic III/uridine 5′- monophosphate hydrolase) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of 5′-Nucleotidase, cytosolic III/uridine 5′-monophosphate hydrolase in the metabolism of UMP, CMP and various nucleoside analog drugs such as gemcitabine and cytosine arabinoside (AraC).

Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2; MIM 191720). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

38 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_001002009

Q9H0P0-1

wet ice

−20℃

human ... NT5C3(51251)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3