Anti-ORAI3 antibody produced in rabbit

HPA015022    Human Protein Atlas characterization data

ORAI3 (ORAI calcium release-activated calcium modulator 3) is one of the three isoforms of the highly selective Ca²⁺ channel called ORAI. This isoform is exclusive to mammals. It contains an ORAI domain in its N-terminal, which is completely conserved. This protein, along with ORAI1, makes the arachidonate-regulated Ca²⁺ (ARC) channel, which is store-independent.

Protein orai-3 recombinant protein epitope signature tag (PrEST)

Anti-ORAI3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

ORAI3 (ORAI calcium release-activated calcium modulator 3) is a key member of the Ca²⁺ release-activated Ca²⁺ (CRAC) pathway, which is the predominant pathway to allow the entry of Ca²⁺ into the cell. This channel is activated when it either interacts with STIM1, or in the presence of 2-aminoethoxydiphenyl borate (2-APB). It is up-regulated in breast cancer cells, and in MCF-7 BC cell line it promotes cell cycle, cell growth and survival. It also regulates c-myc proto-oncogene, though the MAP kinase pathway. This channel is also controlled by estrogen receptor (ER)α, and in ERα⁺ breast cancer, it activates store-operated Ca²⁺ entry (SOCE), and facilitates tumorigenesis. In non-small cell lung adenocarcinoma, it might activate Akt pathway, which is responsible for cell proliferation and cell cycle progression.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73073.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA

Q9BRQ5

wet ice

−20℃

human ... ORAI3(93129)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)