Anti-OSBPL9 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human OSBPL9

Anti-OSBPL9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Oxysterol binding protein-like 9 (OSBPL9; ORP9) belongs to the oxysterol-binding protein family of intracellular lipid receptors. This protein is localized to between the endoplasmic reticulum (ER) and Golgi apparatus. It regulates structure of Golgi and is involved in cholesterol and ceramide transport and synthesis of sphingomyelin. OSBPL9 is a substrate of PDK-2 and negatively regulates Akt by increasing the phosphorylation at Ser473 but not at Thr308.

Synthetic peptide located within the following region: HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

61 kDa

rabbit, dog, human, rat, bovine, horse, guinea pig

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_078862

Q8TAS8

wet ice

−20℃

human ... OSBPL9(114883)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3