Anti-PLXNB1 antibody produced in rabbit

HPA040586    Human Protein Atlas characterization data

Plexin B1 (PLXNB1) gene spanning 21kb with 37 exons is mapped to human chromosome 3p21.31. The encoded protein is predominantly expressed in fetal kidney, digestive system, thyroid, prostate and trachea and is also expressed at lower levels in fetal brain, lung, female reproductive system and liver. PLXNB1 is a member of the plexin family and is characterized with a three IPT (Ig-like, plexins, transcription factors) /TIG domains and one Sema domain.

plexin B1 recombinant protein epitope signature tag (PrEST)

Anti-PLXNB1 antibody produced in rabbit has been used in immunohistochemistry.

Plexin B1 (PLXNB1) interacts with its ligand semaphorin4D (Sema4D) and induces androgen receptor (AR) transcriptional activity by stimulating translocation of AR to the nucleus. It plays a vital role in in signal transduction, intracellular signaling cascade, multicellular organismal development, cell migration, angiogenesis and positive regulation of axonogenesis. Mutation of the gene or elevated expression of the protein is associated with the pathogenesis of prostate cancer. PLXNB1 inhibits the glioma invasiveness and angiogenesis via controlling the Ras homolog gene family, member A (RhoA) /αvβ3/ phosphoinositide-3-kinase/Akt (PI3K/Akt) signaling pathway and serine-arginine protein kinase 1 (SRPK1).Thus, this protein can be considered as a potential therapeutic target for the glioma invasion and angiogenesis.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79469.

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

PGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWC

O43157

wet ice

−20℃

human ... PLXNB1(5364)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1