Anti-POU2F3 antibody produced in rabbit

HPA019652    Human Protein Atlas characterization data

POU class 2 homeobox 3 (POU2F3) is located on human chromosome location 11q23.3.
POU2F3 (POU class 2 homeobox 3) is a homeodomain protein, important for the generation of sweet, umami and bitter taste cells. Specifically, it is localized in stratified squamous epithelia, including the epidermis, cervix and foreskin.

POU domain, class 2, transcription factor 3 recombinant protein epitope signature tag (PrEST)

Anti-POU2F3 antibody produced in rabbit has been used in:

• western blotting
• immunofluorescence
• immunohistochemistry

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

POU2F3 (POU class 2 homeobox 3) is a keratinocyte-specific POU transcription factor, which is majorly responsible for the generation and maintenance of solitary chemosensory cells such as sweet, umami and bitter taste cells. POU2F3 is a tumor suppressor candidate gene in cervical cancer (CC) since; its expression has been found in heterozygosity region on11q23.3. It also participates in keratinocyte proliferation and terminal differentiation.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86702.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP

Q9UKI9

wet ice

−20℃

human ... POU2F3(25833)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1