Anti-PPP1R13L antibody produced in rabbit

NA.41

Rabbit polyclonal anti- PPP1R13L antibody reacts with mouse, human, bovine, and canine protein phosphatase 1, regulatory (inhibitor) subunit 13 like/RelA-associated inhibitor/inhibitory member of the ASPP family proteins.
Protein phosphatase 1, regulatory (inhibitor) subunit 13 like/RelA-associated inhibitor/inhibitory member of the ASPP family (PPP1R13L, RAI, IASPP, NKIP1) is an inhibitor of p53-dependent apoptosis that may play an important roles in pathologies such as leukemogenesis, disease progression of acute leukemias (AL) and pituitary tumorigenesis.

Synthetic peptide directed towards the middle region of human PPP1R13L

Rabbit polyclonal anti- PPP1R13L antibody is used to tag protein phosphatase 1, regulatory (inhibitor) subunit 13 like/RelA-associated inhibitor/inhibitory member of the ASPP family for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of protein phosphatase 1, regulatory (inhibitor) subunit 13 like/RelA-associated inhibitor/inhibitory member of the ASPP family in the regulation of p53-dependent functions such as apoptosis and tumor survival and progression.
Rabbit Anti-PPP1R13L antibody can be used for western blot applications at a concentration of 0.25μg/ml.

IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53), whereas ASPP1 and ASPP2 are activators of p53.IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

89 kDa

bovine, rat, human, horse, pig, mouse, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001135974

Q8WUF5

wet ice

−20℃

human ... PPP1R13L(10848)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3