Anti-PRKAB1, (N-terminal) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human PRKAB1

Anti-PRKAB1, (N-terminal) antibody produced in rabbit is suitable for western blot analysis.

PRKAB1 (protein kinase, AMP-activated, β 1 non-catalytic subunit) is a non-catalytic, β subunit of AMP-activated protein kinase (AMPK). It acts as a metabolic sensor for AMP levels. It plays a key role in energy sensor during the response to energy demand and supply. It regulates cell metabolism. It increases the glycolytic flux by H202 which increase intracellular NADPH content. The activity of PRKAB1 is controlled by decreasing concentrations of adenosine triphosphate (ATP) and increasing AMP concentrations.

Synthetic peptide located within the following region: KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

30 kDa

human, guinea pig, rabbit, horse, bovine, mouse, dog

0.5 mg - 1 mg/mL

western blot: suitable

NM_006253

Q9Y478

wet ice

−20℃

human ... PRKAB1(5564)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3