Anti-prkcz antibody produced in rabbit

NA.41

PRKCZ (Protein kinase C ζ) is a chromosome 1p36.33-p36 located gene belonging to the PKC family of serine/threonine kinases and the aPKC subfamily.

Anti-PRKCZ polyclonal antibody reacts with human, mouse, rat, canine, bovine, and rabbit protein kinase C, zeta proteins.

Synthetic peptide directed towards the N terminal region of human PRKCZ

Anti-PRKCZ polyclonal antibody is used to tag protein kinase C, zeta for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein kinase C, zeta in insulin and glucose signaling and sarcomeric proteins function.

PRKCZ (Protein kinase C ζ) is involved in a variety of cellular processes including cell proliferation, cell motility, and cell survival. It acts as a regulatory molecule in the insulin signaling pathways. It has been suggested that PRKCZ performs downstream of phosphatidylinositol 3-kinase (PI 3-kinase) in the insulin signal pathway, for the translocation of GLUT4-encoded protein. It has also been reported that PRKCZ may act as a negative regulator by phosphorylating insulin receptor substrate-1 (IRS-1), which restricts its ability to activate phosphatidylinositol 3-kinase in response to insulin. It has been documented that PRKCZ might be involved in the pathogenesis of type 2 diabetes mellitus (T2DM). PRKCZ also has been reported to be part of various signaling pathways such as ERK/MAPK activation pathway, p70 ribosomal S6 kinase signaling cascade, activation of transcription factor NF-κB. It also plays a role in the regulation of cell polarity. Study predicts that PRKCZ may also have a role in the ovarian cancer progression.

Synthetic peptide located within the following region: MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

45 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_002735

Q05513

wet ice

−20℃

human ... PRKCZ(5590)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3