Anti-RAP1GDS1 antibody produced in rabbit

HPA019060    Human Protein Atlas characterization data

The gene RAP1GDS1 (rap1 GTPase-GDP dissociation stimulator 1) is mapped to human chromosome 4q23. The protein localizes in the cytoplasm, mitochondria and endoplasmic reticulum. RAP1GDS1 is also referred as smgGDS (SMG P21 stimulatory GDP/GTP exchange protein).

Rap1 GTPase-GDP dissociation stimulator 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

RAP1GDS1 (rap1 GTPase-GDP dissociation stimulator 1) is a guanine exchange factor which is responsible for promoting prenylation and trafficking of Ras and Rho family members containing polybasic region. The longer form of RAP1GDS1 controls entry of non-prenylated GTPases into the prenylation pathway. The shorter form regulates trafficking of prenylated GTPases to the plasma membrane. RAP1GDS1 also regulates cell cycle progression. It is up-regulated in non-small cell lung carcinoma, prostate cancer, breast cancer and pancreatic cancer.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74807.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGA

P52306

wet ice

−20℃

human ... RAP1GDS1(5910)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1