Anti-RASGRF2 antibody produced in rabbit

MFCD01634087

HPA018679    Human Protein Atlas characterization data

The gene Ras-specific guanine nucleotide-releasing factor-2 (RASGRF2) is mapped to human chromosome 5q13. It belongs to a family of calcium/calmodulin-regulated guanine-nucleotide exchange factors. RASGRF2 transcripts are abundantly expressed in human brain tissue. Low levels of RASGRF2 are also detected in human heart, placenta, kidney, pancreas, human ovary and spleen tissues. The protein localizes to the cytoplasm. However, depending upon the interaction partner it can translocate to the cell periphery. RasGRF2 protein contains two pleckstrin homology (PH) regions, a coiled-coil motif, a Ca²⁺/calmodulin binding ilimaquinone (IQ) domain, a Dbl homology (DH) region and the prototypical Cdc25 (Ras-specific guanine nucleotide-releasing factor 1) Ras exchange domain.

Ras-specific guanine nucleotide-releasing factor 2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

In neurons, p35/CDK5 (cyclin-dependent like kinase 5) phosphorylates Ras-specific guanine nucleotide-releasing factor-2 (RASGRF2), thereby modulating Rac-dependent extracellular signal-regulated kinase (ERK1/2) activity and microtubule-associated protein-1b distribution. RASGRF2 is also involved in T-cell signaling. Presence of RASGRF2 in T-cells activates Ras and stimulates the transcriptional factor NF-AT (nuclear factor of activated T cells).

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74632.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:50- 1:200

FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD

O14827

wet ice

−20℃

human ... RASGRF2(5924)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1