Anti-RBM8A antibody produced in rabbit

HPA018403    Human Protein Atlas characterization data

The gene RBM8A (RNA-binding motif protein 8A) is mapped to human chromosome 1q21.1. It belongs to a conserved RNA-binding motif protein family. RBM8A is ubiquitously expressed in human tissues. The protein shuttles between the nucleus and the cytoplasm. The protein is popularly known as Y14.

RNA-binding protein 8A recombinant protein epitope signature tag (PrEST)

Anti-RBM8A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

RNA-binding motif protein 8A (RBM8A) is an RNA binding protein. It is part of the exon-exon junction complex (EJC), which is present on the exon-exon junctions of spliced mRNAs. RBM8A interacts with UPF3B (up-frameshift suppressor-3 homolog B) and together they are essential for nonsense-mediated mRNA decay. RBM8A also controls the alternative splicing of apoptotic regulators. Absence of RBM8A increase production of proapoptotic Bcl-x(S) splice variant. Apart from being an exon junction complex protein, RBM8A associates with receptor-interacting protein-1 (RIP1) and TNFR (tumor necrosis factor receptor)-associated death domain, and positively regulates TNF-α-induced IL (Interleukin)-6 expression in HeLa cells. RBM8A interacts directly with decapping factor DCP2 and the 5′ cap structure of mRNAs, and inhibits the mRNA-decapping activity of DCP2. RBM8A interacts with STAT3 (signal transducer and activator of transcription-3) and regulates its activation by influencing the IL-6-induced tyrosine-phosphorylation of STAT3.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73962.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

RNAi knockdown
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV

Q9Y5S9

wet ice

−20℃

human ... RBM8A(9939)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)