Anti-SEC61B antibody produced in rabbit

NA.41

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. (provided by RefSeq)

SEC61B (NP_006799.1, 1 a.a. ~ 96 a.a) full-length human protein.

Sequence
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

Solution in phosphate buffered saline, pH 7.4

rabbit

unconjugated

purified immunoglobulin

primary antibodies

polyclonal

buffered aqueous solution

human

western blot: 1 μg/mL

NM_006808.2

P60468

dry ice

−20℃

human ... SEC61B(10952)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids