Anti-SELENOS antibody produced in rabbit

HPA010025    Human Protein Atlas characterization data

Selenoprotein S (SELS) is a transmembrane protein that is composed of 189 amino acids. Alternative splicing produces two isoforms of this enzyme, which are different at their 3′UTR (untranslated region) sequences. Both these isoforms are widely expressed. It is one of the most widely present selenoproteins in eukaryotes. This protein is localized to the ER (endoplasmic reticulum).

selenoprotein S recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)
Western Blotting (1 paper)
Anti-SELS antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Selenoprotein S (SELS) plays a crucial, though unidentified role in unfolded protein response. It is thought to act as a reductase. The levels of this protein are regulated by circulating glucose and insulin levels, which share an inverse relation with each other. Polymorphism -105G>A in this gene is linked with increased susceptibility to Kashin-Beck disease (KBD), where it regulates the expression of expression of PI3K (phosphatidylinositol 3-kinase)/Akt signaling pathway. It plays an essential role in the production of inflammatory cytokines. In mice, it might confer protection against LPS (lipopolysaccharide)-induced sepsis and organ damage. Therefore, it might have potential as a therapeutic target LPS-induced sepsis. Variants present in the promoter region of SELS are linked with increased susceptibility to Hashimoto′s thyroiditis.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71935.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

RNAi knockdown
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR

wet ice

−20℃

human ... SELS(55829)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)