Anti-SLC26A5 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human SLC26A5

Anti-SLC26A5 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

SLC26A5 (Prestin), a member of SLC26 family, is an anion transporter that functions at microsecond rates. It is expressed at the basolateral membrane of cochlear outer hair cells and modulates the sensitivity of mammalian hearing. Mutations in the gene encoding for prestin result in neurosensory deafness.

Synthetic peptide located within the following region: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

81 kDa

rat, guinea pig, horse, mouse, bovine, human, rabbit, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_945350

P58743

wet ice

−20℃

human ... SLC26A5(375611)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3